Visao Geral LL-37 is a 37-residue cationic antimicrobial peptide (AMP) e o(a) only member do(a) cathelicidin family identificado(a) in humans. Its aminoacido sequence is [LL-37, 37 aa][1] Parent molecule: LL-37 is derivado(a) de a larger, inactive precursor protein called hCAP18 (human Cationic Antimicrobial Protein, 18 kDa). The CAMP gene on chromosome 3p21.3 encodes hCAP18. The ativo(a) LL-37 peptide is released extracellularly through proteolytic cleavage — primariamen

How does LL-37 work? What is its mechanism of action?

Mecanismo de Acao Primary Antimicrobial: "Carpet-Like" Membrane Disruption LL-37 disrupts bacterial membranes via electrostatic attraction to anionic bacterial surfaces → hydrophobic insertion → toroidal pore formation or micellization ("carpet-like" mechanism). It acts preferentially on Gram-negative bacteria but is eficaz against ambos(as) Gram-positive and drug-resistant strains. Eukaryotic membranes are protegeu by alto(a) cholesterol content.[3][7] Receptor Targets ReceptorTypeFunctional Ef

What are the research applications of LL-37?

Aplicacoes de Pesquisa LL-37 research spans antimicrobial resistance, cicatrizacao de feridas, oncology, and immunology across 8+ indication categories: Chronic Wound Healing — Promotes granulation tissue, re-epitelialization, and angiogenese in venous leg ulcers (VLUs) and diabetic foot ulcers (DFUs).[5][13] Antimicrobial Resistance — Broad-spectrum activity against MDR bacteria; anti-biofilm; synergy with conventional antibiotics (azithromycin, colistin, ciprofloxacin, vancomycin).[7] Oncology

What does the research summary say about LL-37?

Resumo da Pesquisa Pre-clinica Key Preclinical Studies EstudoModeloPrincipais AchadosRef Zhang et al. (2022)C57/BL6 mice, Pan02 PDAC — 20 mg/kg/day IP × 14d42% reduction in tumor growth (p[11] Overhage et al. (2008)P. aeruginosa biofilm — 0.5 µg/mLInhibits biofilm formation via quorum-sensing downregulacao (Las/Rhl); promove twitching motility at sub-MIC[7] Wu et al. (2010)Colon cancer cellsLL-37 inibe proteasome → ativa BMP signaling → p21Waf1 → cell cycle arrest[10] Koczulla et al. (2003)Dexam

How should LL-37 be stored?

Lyophilized pó/concentrado armazenado a -20°C. Formulação em creme estável >99 meses a 4°C, >75 meses a 28°C (derrete a 40°C). Soluções reconstituídas devem ser used immediately ou congeladas.

Storing LL-37: Best Practices

24 Citacoes PubMedRevisado por EspecialistasCertificado GMPUltima Revisao: fevereiro de 2026

Condições Recomendadas de Armazenamento Laboratorial

Liofilizado Powder/Concentrate: Store frozen at -20°C. Stable por períodos prolongados in liofilizado form.

Cream Formulation: Clinical-grade LL-37 cream mantem >90% ativo(a) ingredient por até 99 months at 4°C and 75 months at 28°C. Cream melts at 40°C — store below this threshold.

Reconstitution: Use sterile diluent (polyvinyl alcohol or agua bacteriostatica). Use immediately or keep frozen para prevenir degradacao and agregacao.

Form: Synthetic peptide acetate salt via solid-phase peptide synthesis (SPPS); liofilizado sterile powder.

Purity: ≥90–110% content by HPLC (UV at 217 nm); identity confirmou by LC-MS.

Handling: Allow vials to warm to room temperature before opening para prevenir moisture condensation.

Editorial Research Note

“Resumo da Pesquisa Pre-clinica Key Preclinical Studies EstudoModeloPrincipais AchadosRef Zhang et al.”

Pure U.S. Peptides Research Standards TeamInternal editorial group summarising published peptide research for an audience of qualified independent investigators.

Referencias

Perguntas de Pesquisa Relacionadas

→ What Is LL-37?→ LL-37: Mechanism of Action → LL-37: Research Applications → LL-37: Safety Profile & Research Summary → LL-37: Chemical Properties

Related research

What is TB-500?What is VIP?What is BPC-157?

Browse all research guides in the Peptide Research Library →

Deseja a revisao completa da pesquisa?

Ver Pagina Completa de Pesquisa de LL-37→

APENAS PARA USO EM PESQUISA

Este conteudo e fornecido apenas para fins educacionais e informativos. Os produtos sao fornecidos apenas para estudos in vitro e nao sao medicamentos, drogas ou suplementos. Nao aprovado pela FDA para prevenir, tratar ou curar qualquer condicao.