What Is LL-37?
Quick Answer
Overview LL-37 is a 37-residue cationic antimicrobial peptide (AMP) and the only member of the cathelicidin family identified in humans. Its amino acid sequence is [LL-37, 37 aa][1] Parent molecule: LL-37 is derived from a larger, inactive precursor protein called hCAP18 (hum...
LL-37 β Quick Facts
| Molecular formula | C205H340N60O53 |
|---|---|
| Molecular weight | 4493 g/mol |
| InChI key | POIUWJQBRNEFGX-XAMSXPGMSA-N |
| PubChem CID | 16198951 |
| Storage | Lyophilized powder/concentrate stored at -20Β°C. Cream formulation stable >99 months at 4Β°C, >75 months at 28Β°C (melts at 40Β°C). Reconstituted solutions should be used immediately or frozen. |
| Cited references | 24 |
Chemical identity from PubChem CID 16198951. For research use only.
Overview
LL-37 is a 37-residue cationic antimicrobial peptide (AMP) and the only member of the cathelicidin family identified in humans. Its amino acid sequence is [LL-37, 37 aa][1]
Parent molecule: LL-37 is derived from a larger, inactive precursor protein called hCAP18 (human Cationic Antimicrobial Protein, 18 kDa). The CAMP gene on chromosome 3p21.3 encodes hCAP18. The active LL-37 peptide is released extracellularly through proteolytic cleavage β primarily by proteinase 3 in neutrophils and kallikreins (K5/K7) in keratinocytes.[2]
Cellular origin: Constitutively expressed or induced in neutrophils (stored in specific granules), monocytes, mast cells, and epithelial cells of the skin, gastrointestinal tract, and respiratory tract.[3]
Structurally, LL-37 is a linear, amphipathic peptide (MW 4493.33 Da) with a net charge of +6 at physiological pH. It is cysteine-free and adopts an Ξ±-helical structure in membrane environments but remains disordered in aqueous solution. NMR studies reveal a curved helix-bend-helix motif spanning residues 2β31 with a disordered C-terminal tail.[1]
LL-37 expression in the skin is regulated by Vitamin D. Abnormal LL-37 levels are linked to psoriasis (overexpression) and atopic dermatitis (suppression).[6]
Discovery and evolutionary context
The cathelicidin family is conserved across vertebrates, encompassing structurally diverse C-terminal mature peptides (alpha-helical, beta-sheet, proline-rich) all derived from the homologous N-terminal cathelin pro-domain. LL-37 stands out as the sole human representative; its murine ortholog CRAMP shares functional homology but differs in sequence and exact bioactivity profile. The hCAP18 precursor accumulates in neutrophil specific granules and is released into the extracellular space upon degranulation, where extracellular proteinase 3 cleavage liberates the active LL-37 peptide.[1][2]
Research framework
Within the host-defense and antimicrobial-peptide research domain, LL-37 is most directly compared with KPV for parallel anti-inflammatory and innate-immune signaling, with Thymosin alpha-1 for companion immunoregulatory profiles, and with BPC-157 for shared wound-healing and angiogenic crosstalk. The compound is supplied here strictly as a research reference standard for in vitro and animal-model investigation, and is not intended for human or veterinary use.
βPreclinical Research Summary Key Preclinical Studies StudyModelKey FindingsRef Zhang et al.β
References
- Johansson J, Gudmundsson GH, Rottenberg ME, et al. Conformation-dependent antibacterial activity of the naturally occurring human peptide LL-37. Journal of Biological Chemistry. 1998;273(6):3718-3724.
- Gudmundsson GH, Agerberth B, Odeberg J, et al. The human gene FALL39 and processing of the cathelin precursor to the antibacterial peptide LL-37 in granulocytes. European Journal of Biochemistry. 1996;238(2):325-332.
- Ridyard KE, Overhage J. The Potential of Human Peptide LL-37 as an Antimicrobial and Anti-Biofilm Agent. Antibiotics. 2021;10(6):650.
- Duplantier AJ, van Hoek ML. The Human Cathelicidin Antimicrobial Peptide LL-37 as a Potential Treatment for Polymicrobial Infected Wounds. Frontiers in Immunology. 2013;4:143.
- GrΓΆnberg A, Mahlapuu M, StΓ₯hle M, et al. Treatment with LL-37 is Safe and Effective in Enhancing Healing of Hard-to-Heal Venous Leg Ulcers: A Randomized, Placebo-Controlled Clinical Trial. Wound Repair and Regeneration. 2014;22(5):613-621.
- Yang B, Good D, Mosaiab T, et al. Significance of LL-37 on Immunomodulation and Disease Outcome. BioMed Research International. 2020;2020:8349712.
- Heilborn JD, Nilsson MF, Kratz G, et al. The cathelicidin anti-microbial peptide LL-37 is involved in re-epithelialization of human skin wounds and is lacking in chronic ulcer epithelium. Journal of Investigative Dermatology. 2003;120(3):379-389.
- Scott MG, Davidson DJ, Gold MR, et al. The human antimicrobial peptide LL-37 is a multifunctional modulator of innate immune responses. The Journal of Immunology. 2002;169(7):3883-3891.
- Svensson D, Nilsson BO. Human antimicrobial/host defense peptide LL-37 may prevent the spread of a local infection through multiple mechanisms: an update. Inflammation Research. 2025;74(1):36.
- Piktel E, Niemirowicz K, Wnorowska U, et al. The Role of Cathelicidin LL-37 in Cancer Development. Archivum Immunologiae et Therapiae Experimentalis. 2016;64(1):33-46.
- Zhang Z, Chen WQ, Zhang SQ, et al. The human cathelicidin peptide LL-37 inhibits pancreatic cancer growth by suppressing autophagy and reprogramming of the tumor immune microenvironment. Frontiers in Pharmacology. 2022;13:906625.
- Lu F, Zhu Y, Zhang G, Liu Z. Renovation as innovation: Repurposing human antibacterial peptide LL-37 for cancer therapy. Frontiers in Pharmacology. 2022;13:944147.
- Miranda E, Bramono K, Yunir E, et al. Efficacy of LL-37 cream in enhancing healing of diabetic foot ulcer: a randomized double-blind controlled trial. Archives of Dermatological Research. 2023;315(9):2623-2633.
- Seil M, Nagant C, Dehaye JP, et al. Spotlight on Human LL-37, an Immunomodulatory Peptide with Promising Cell-Penetrating Properties. Pharmaceuticals. 2010;3(11):3435-3460.
- ErgΓΌn FC, Kars MD, Kars G. Development and Characterization of LL37 Antimicrobial-Peptide-Loaded Chitosan Nanoparticles. Polymers. 2025;17(13):1884.
- Mahlapuu M, Sidorowicz A, Mikosinski J, et al. Evaluation of LL-37 in healing of hard-to-heal venous leg ulcers: A multicentric prospective randomized placebo-controlled clinical trial. Wound Repair and Regeneration. 2021;29(6):938-950.
- Ohuchi K, Ikawa T, Amagai R, et al. LL-37 Might Promote Local Invasion of Melanoma by Activating Melanoma Cells and Tumor-Associated Macrophages. Cancers. 2023;15(6):1678.
- Miura S, Garcet S, Li X, et al. Cathelicidin Antimicrobial Peptide LL37 Induces Toll-Like Receptor 8 and Amplifies IL-36Ξ³ and IL-17C in Human Keratinocytes. Journal of Investigative Dermatology. 2023;143(5):832-841.e4.
- Lin X, Wang R, Mai S. Advances in delivery systems for the therapeutic application of LL37. Journal of Drug Delivery Science and Technology. 2020;60(9):102016.
- Wu WK, Wang G, Coffelt SB, et al. Emerging Roles of the Host Defense Peptide LL-37 in Human Cancer and its Potential Therapeutic Applications. International Journal of Cancer. 2010;127(8):1741-1747.
- Alalwani SM, Sierigk J, Herr C, et al. The antimicrobial peptide LL-37 modulates the inflammatory and host defense response of human neutrophils. European Journal of Immunology. 2010;40(4):1118-1126.
- Lozeau LD, Kole D, Dominko T, et al. Activity and toxicity of a recombinant LL37 antimicrobial peptide. Frontiers in Bioengineering and Biotechnology. 2016.
- Wan W, Zhang L, Lin Y, et al. Mitochondria-derived peptide MOTS-c: effects and mechanisms related to stress, metabolism and aging. Journal of Translational Medicine. 2023;21(1):36.
- M.D. Anderson Cancer Center. Induction of Antitumor Response in Melanoma Patients Using the Antimicrobial Peptide LL37. ClinicalTrials.gov Protocol NCT02225366. 2015.
Related Research Questions
Related research
Browse all research guides in the Peptide Research Library βWant the complete research review?
View Full LL-37 Research PageβFOR RESEARCH USE ONLY
This content is provided for educational and informational purposes only. Products are furnished for in-vitro studies only and are not medicines, drugs, or supplements. Not approved by the FDA to prevent, treat, or cure any condition.
