Sermorelin vs Tesamorelin: GHRH Analog Research Comparison
Quick Summary
Sermorelin and Tesamorelin are both growth hormone-releasing hormone (GHRH) analogs that stimulate pituitary GH secretion. Sermorelin corresponds to the first 29 amino acids of GHRH(1-44), while Tesamorelin is a modified full-length GHRH with a trans-3-hexenoic acid group. Tesamorelin is the only GHRH analog with FDA approval (for HIV-associated lipodystrophy), making these two compounds a natural pairing for comparative analysis.
Sermorelin
Sermorelin (GHRH 1-29) is a synthetic 29-amino acid peptide with a molecular weight of 3,357.88 Da. It corresponds to the N-terminal segment of the endogenous 44-amino acid GHRH molecule and is considered the shortest fully functional fragment retaining full biological...
Tesamorelin
Tesamorelin (TH9507) is a synthetic 44-amino acid analog of endogenous GHRH with a molecular weight of 5135.9 Da. It was developed by Theratechnologies Inc. to overcome the inherent instability of native GHRH, which has a half-life of only 3β8 minutes...
Research Comparison: Sermorelin vs Tesamorelin
| Dimension | Sermorelin | Tesamorelin |
|---|---|---|
| Structure | GHRH(1-29)NHβ β first 29 amino acids of native GHRH | Trans-3-hexenoic acid modified GHRH(1-44) β full-length analog |
| Amino Acid Length | 29 amino acids | 44 amino acids + hexenoic acid modification |
| Primary Mechanism | GHRH receptor agonism β pituitary GH release | GHRH receptor agonism β enhanced GH pulsatility |
| FDA Status | Previously approved (Geref, withdrawn from market); investigational | FDA-approved (Egrifta) for HIV-associated lipodystrophy |
| Primary Research Focus | GH deficiency, age-related GH decline, diagnostic testing | Visceral adipose tissue reduction, HIV lipodystrophy, NAFLD |
| Half-Life | ~10-20 minutes (short) | ~26-38 minutes (longer due to modification) |
| Key Clinical Findings | Restored physiological GH pulsatility in aging subjects | ~18% reduction in visceral adipose tissue vs placebo in Phase III |
| IGF-1 Response | Moderate increase in IGF-1 levels | Significant increase in IGF-1 (p<0.001 vs placebo) |
| Research Stage | Extensive clinical history; currently investigational | FDA-approved product with ongoing Phase III/IV trials |
| Unique Research Areas | Cognitive function, sleep quality, diagnostic GHRH stimulation test | NAFLD/liver fat reduction, cardiovascular biomarkers |
Chemical Properties Comparison
| Property | Sermorelin | Tesamorelin |
|---|---|---|
| Molecular Formula | CβββHβββNββOββS | CβββHβββNββOββS |
| Molecular Weight | 3,357.88 Da | 5135.9 Da |
| CAS Number | 86168-78-7 | 218949-48-5 (free base); 901758-09-6 (acetate) |
| Amino Acid Sequence | YADAIFTNSYRKVLGQLSARKLLQDIMSR-NHβ (29 aa) | hexenoyl-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NHβ (44 aa) |
| PubMed Citations | 20 referenced | 24 referenced |
Explore Full Research Profiles
Sermorelin
Sermorelin (GHRH 1-29) is a synthetic 29-amino acid peptide with a molecular weight of 3,357.88 Da. It corresponds to the N-terminal segment of the endogenous 44-amino acid GHRH molecule and is considered the shortest fully functional fragment retaining full biological...
Tesamorelin
Tesamorelin (TH9507) is a synthetic 44-amino acid analog of endogenous GHRH with a molecular weight of 5135.9 Da. It was developed by Theratechnologies Inc. to overcome the inherent instability of native GHRH, which has a half-life of only 3β8 minutes...
More Peptide Comparisons
For Research Use Only (RUO). This comparison is for educational and informational purposes only. All products are intended solely for in-vitro research and laboratory experimentation. Products have not been approved by the FDA for human or veterinary use. Pure U.S. Peptides does not condone or encourage the use of these products for anything other than strictly defined research applications.
