Visao Geral LL-37 is a 37-residue cationic antimicrobial peptide (AMP) e o(a) only member do(a) cathelicidin family identificado(a) in humans. Its aminoacido sequence is [LL-37, 37 aa][1] Parent molecule: LL-37 is derivado(a) de a larger, inactive precursor protein called hCAP18 (human Cationic Antimicrobial Protein, 18 kDa). The CAMP gene on chromosome 3p21.3 encodes hCAP18. The ativo(a) LL-37 peptide is released extracellularly through proteolytic cleavage — primariamen

How does LL-37 work? What is its mechanism of action?

Mecanismo de Acao Primary Antimicrobial: "Carpet-Like" Membrane Disruption LL-37 disrupts bacterial membranes via electrostatic attraction to anionic bacterial surfaces → hydrophobic insertion → toroidal pore formation or micellization ("carpet-like" mechanism). It acts preferentially on Gram-negative bacteria but is eficaz against ambos(as) Gram-positive and drug-resistant strains. Eukaryotic membranes are protegeu by alto(a) cholesterol content.[3][7] Receptor Targets ReceptorTypeFunctional Ef

What are the research applications of LL-37?

Aplicacoes de Pesquisa LL-37 research spans antimicrobial resistance, cicatrizacao de feridas, oncology, and immunology across 8+ indication categories: Chronic Wound Healing — Promotes granulation tissue, re-epitelialization, and angiogenese in venous leg ulcers (VLUs) and diabetic foot ulcers (DFUs).[5][13] Antimicrobial Resistance — Broad-spectrum activity against MDR bacteria; anti-biofilm; synergy with conventional antibiotics (azithromycin, colistin, ciprofloxacin, vancomycin).[7] Oncology

What does the research summary say about LL-37?

Resumo da Pesquisa Pre-clinica Key Preclinical Studies EstudoModeloPrincipais AchadosRef Zhang et al. (2022)C57/BL6 mice, Pan02 PDAC — 20 mg/kg/day × 14d42% reduction in tumor growth (p[11] Overhage et al. (2008)P. aeruginosa biofilm — 0.5 µg/mLInhibits biofilm formation via quorum-sensing downregulacao (Las/Rhl); promove twitching motility at sub-MIC[7] Wu et al. (2010)Colon cancer cellsLL-37 inibe proteasome → ativa BMP signaling → p21Waf1 → cell cycle arrest[10] Koczulla et al. (2003)Dexameth

How should LL-37 be stored?

Pó liofilizado/concentrado armazenado a -20°C.

LL-37: Safety Profile & Research Summary

$47.25 · COA do lote publicado · Água BAC grátis + frete grátis nos EUA · Despacho no mesmo dia antes das 14h ET · APENAS PARA USO EM PESQUISA

Comprar peptídeo LL-37 5mg (Cathelicidin)

24 Citacoes PubMedRevisado por EspecialistasUltima Revisao: fevereiro de 2026

Resumo da Pesquisa Pre-clinica

Key Preclinical Studies

Estudo	Modelo	Principais Achados	Ref
Zhang et al. (2022)	C57/BL6 mice, Pan02 PDAC — 20 mg/kg/day × 14d	42% reduction in tumor growth (p<0.05); ↓ MDSCs and M2 macrofagos (p<0.01); ↑ CD4+/CD8+ T cells (p<0.01); fewer AEs vs gemcitabine	[11]
Overhage et al. (2008)	P. aeruginosa biofilm — 0.5 µg/mL	Inhibits biofilm formation via quorum-sensing downregulacao (Las/Rhl); promove twitching motility at sub-MIC	[7]
Wu et al. (2010)	Colon cancer cells	LL-37 inibe proteasome → ativa BMP signaling → p21Waf1 → cell cycle arrest	[10]
Koczulla et al. (2003)	Dexamethasone-treated mice — topico(a) LL-37	Increased vascularization and re-epitelialization; key role in wound regeneration via angiogenese	[9]
Beaumont et al. (2014)	Bone marrow stromal cells	Stimulates proliferacao and osteogenic diferenciacao of BMSCs; recruits MSCs to injury sites	[14]
Tuberculosis (in vivo)	M. tuberculosis mice — ~1 mg/kg × 28d	3–10 fold reduction in lung bacilli; eficaz against drug-sensitive and MDR strains	[7]

Clinical Trials

Ensaio	Population	Intervention	Key Results	Ref
Phase IIb VLU	n=148	13 wk	Ulcer-closure and healing-rate endpoints (total and subgroup)	[16]
Phase I/II VLU	n=34	Three concentrations vs placebo (4 wk)	Healing-rate and ulcer-area endpoints	[5]
RCT — DFU	n=25	4-week study	Granulation-index and bacterial-load endpoints	[13]
Phase I Melanoma	n=36 planned	8-week study	Tolerability and biological-response endpoints	[17]

Safety Summary

Parametro	Finding
Clinical	Safe and bem tolerado(a) in 148-subject Phase IIb; no sistemico(a) safety concerns; mild local reactions (redness, edema)
Dose-Dependent	3.2 mg/mL → aumentou local reactions; bell-shaped dose-response
Cytotoxicity	>13–25 µM towards eukaryotic cells; significantly inibido(a) por serum
Cancer Risk	Context-dependent: anti-tumorigenic in colon/gastric/pancreatic; pro-tumorigenic in breast/lung/ovarian/melanoma
Pharmacological Interactions (preclinical)	Synergy with antibiotics (azithromycin, colistin, vancomycin); inibido(a) por glycosaminoglycans; Vitamin D upregula expression
Stability	Susceptible to protease degradacao; short plasma meia-vida; D-LL-37 enantiomer is protease-resistant

Os produtos oferecidos neste site são fornecidos apenas para estudos in vitro. Estudos in vitro (do latim: em vidro) são realizados fora do corpo. Estes produtos não são medicamentos ou fármacos e não foram aprovados pelo FDA dos EUA para prevenir, tratar ou curar qualquer condição médica, enfermidade ou doença. A introdução corporal de qualquer tipo em humanos ou animais é estritamente proibida por lei.

Apenas para Pesquisa Laboratorial. Não se destina ao uso humano, uso médico, uso diagnóstico ou uso veterinário.

TODOS OS ARTIGOS E INFORMAÇÕES SOBRE PRODUTOS FORNECIDOS NESTE SITE SÃO APENAS PARA FINS INFORMATIVOS E EDUCACIONAIS.

Aviso sobre Estudos In Vitro / Pré-clínicos: Os achados de pesquisa descritos acima foram observados em estudos laboratoriais (in vitro) e/ou em modelos animais. Esses resultados podem não se traduzir em desfechos humanos. Nenhuma alegação é feita em relação a aplicações terapêuticas humanas.

Apenas para Uso Educacional: Este conteúdo resume a literatura laboratorial e clínica publicada apenas para referência de pesquisa. Não é aconselhamento médico.

Editorial Research Note

“Resumo da Pesquisa Pre-clinica Key Preclinical Studies EstudoModeloPrincipais AchadosRef Zhang et al.”

Pure U.S. Peptides Research Standards TeamInternal editorial group summarising published peptide research for an audience of qualified independent investigators.

Referencias

Perguntas de Pesquisa Relacionadas

→ What Is LL-37?→ LL-37: Mechanism of Action → LL-37: Research Applications → LL-37: Chemical Properties → Storing LL-37: Best Practices

Related research

TB-500 — Safety profile VIP — Safety profile BPC-157 — Safety profile

Browse all research guides in the Peptide Research Library →

Deseja a revisao completa da pesquisa?

Comprar peptídeo LL-37 5mg (Cathelicidin)→

APENAS PARA USO EM PESQUISA

Este conteudo e fornecido apenas para fins educacionais e informativos. Os produtos sao fornecidos apenas para estudos in vitro e nao sao medicamentos, drogas ou suplementos. Nao aprovado pela FDA para prevenir, tratar ou curar qualquer condicao.